BLASTX 2.2.6 [Apr-09-2003]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Candida_albicans_chr7-f3-171720-172424-1
         (702 letters)

Database: sptrembl 
           1,070,300 sequences; 339,323,595 total letters

Searching.................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

O13547|CCW14|CW14_YEAST (SP: Saccharomyces cerevisiae (Baker's y...    58   1e-07

>O13547|CCW14|CW14_YEAST (SP: Saccharomyces cerevisiae (Baker's
           yeast)) Covalently-linked cell wall protein 14 precursor
           (Inner cell wall protein).
          Length = 238

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +1

Query: 94  VAKVEKGSK-CSGLNDLSCICTTKNSDVEKCLKEICPNGDADTAISAFK 237
           VA+V K S  C  LN ++C C  +NS V+KCL  ICPN DAD A SAFK
Sbjct: 32  VAQVGKSSSTCDSLNQVTCYCEHENSAVKKCLDSICPNNDADAAYSAFK 80


  Database: sptrembl
    Posted date:  Oct 14, 2003  6:47 PM
  Number of letters in database: 339,323,595
  Number of sequences in database:  1,070,300
  
Lambda     K      H
   0.314    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 52,830,318
Number of Sequences: 1070300
Number of extensions: 583161
Number of successful extensions: 1844
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1832
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1843
length of database: 339,323,595
effective HSP length: 118
effective length of database: 213,028,195
effective search space used: 24498242425
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)