Query: Candida_albicans_chr7-f3-135510-136031-3 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- bZIP bZIP transcription factor 6.4 0.21 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- bZIP 1/1 88 152 .. 1 65 [] 6.4 0.21 Alignments of top-scoring domains: bZIP: domain 1 of 1, from 88 to 152: score 6.4, E = 0.21 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk + + ++ +N+ A+ r+R +K+++ +e e++++eLe+ L k Candida_al 88 ASASAADDKRKRNTAASARFRIKKKMKEQEMERRAKELEERVVNLEK 134 elerLkkevakLksenee<-* +l+ + e+ Lk+ + Candida_al 135 KLKAAELENRCLKNIIFQ 152 //