Query: Candida_albicans_chr7-r1-35384-34632-3 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- rrm RNA recognition motif. (a.k.a. RRM, RB 79.4 7.5e-20 1 Pox_A_type_inc Viral A-type inclusion protein repeat 13.2 6 1 PFEMP Plasmodium falciparum erythrocyte memb -84.5 5.9 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Pox_A_type_inc 1/1 88 110 .. 1 23 [] 13.2 6 PFEMP 1/1 1 119 [. 1 170 [] -84.5 5.9 rrm 1/1 128 199 .. 1 77 [] 79.4 7.5e-20 Alignments of top-scoring domains: Pox_A_type_inc: domain 1 of 1, from 88 to 110: score 13.2, E = 6 *->rEldrlRrrIsdLekqLsdcrrn<-* +E++++ ++++L++qLs + n Candida_al 88 EEMEQETAKLRELHSQLSSESTN 110 PFEMP: domain 1 of 1, from 1 to 119: score -84.5, E = 5.9 *->FFkrWVeyfLeDsikWrkKlshCIkngkgkkcckcinGCkkkCeCfe +++ si+ ++s+ n ckc nGC Candida_al 1 --------MVIHSIDVVYRISR--FNPRSHRNCKCKNGC-------- 29 KWiekKkkErWkkIKeH.FnkQykikdged.tflgiPifldeyldlesfL E ++ +F+++++ k+++++t lgi l + ++ s+ Candida_al 30 --------E---NVLALdFENNKRKKKKTPkT-LGI---LLAVPNNLSIM 64 Edlqfqidikkaygdakelkkikellkcngennsansakengtvgvgeek +q +++ + + + ++ k+ l + e++ Candida_al 65 -SDQI--PVENQQVPSENSEEVKNKLEE------------------MEQE 93 da.IDcLLdhLekkAkkCkkkhseee<-* +a+ +L ++L + ++ +++ +ee Candida_al 94 TAkLRELHSQLSSESTNGVTHPTDEE 119 rrm: domain 1 of 1, from 128 to 199: score 79.4, E = 7.5e-20 *->lfVgNLppdvteedLkdlFskfGpivsikivkDhkektketgkskGf +++gN + t +L ++Fs G +++++i ++ k tg++kGf Candida_al 128 IYIGNVDYGSTPLELQQHFSSAGVVNRVTILTN-----KFTGQPKGF 169 aFVeFeseedAekAlealnGkelggrklrv<-* a+ eF++ ++++kA+++l+G +++ r l+v Candida_al 170 AYLEFADTDAVNKAVATLDGSTFRERQLKV 199 //