Query: Candida_albicans_chr7-r1-6467-5799-9 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ADK Adenylate kinase 182.6 6.2e-51 1 ADK_lid Adenylate kinase, active site lid 67.2 3.4e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ADK_lid 1/1 133 168 .. 1 37 [] 67.2 3.4e-16 ADK 1/1 8 197 .. 1 152 [] 182.6 6.2e-51 Alignments of top-scoring domains: ADK_lid: domain 1 of 1, from 133 to 168: score 67.2, E = 3.4e-16 *->RriCpnCGrvYHleFnPPKveGkCDvcGseeLvqReD<-* R+i+ ++GrvY+l +nPPKv+ k+Dv+G e L +R D Candida_al 133 RWIHEASGRVYNLDYNPPKVPFKDDVTG-EALTKRQD 168 ADK: domain 1 of 1, from 8 to 197: score 182.6, E = 6.2e-51 RF xxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxxxxxxxxxxxxxxxx *->llGpPGaGKGTQaekIvkky.givHLSTGDlLRaevksgTelGkeaK llG+PG+GKGTQ ++ k +++++ LS+GD+LR +++sg+ +G ea+ Candida_al 8 LLGAPGSGKGTQTSRLLKRFtQLQSLSSGDILRNQIRSGSAIGGEAQ 54 RF xxxxxxxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxxxxxxxxxxxxx eyMdkGeLVPDevvvglvkerleqn..ndcknGFLLDGFPRtvpQAeaLe +y+++G LVPD ++vgl+ +le+++ +++ +LLDGFPRtv QA +L+ Candida_al 55 TYIKNGSLVPDNIMVGLITAELEKKkwLTQSSSWLLDGFPRTVNQARELD 104 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxx emLeeagikldaVleldVpdevLveRltg..................... + + + ++V+eldV++ v+ +R+ + ++ +++ + + ++++ + Candida_al 105 RVI-HDRANFNLVVELDVDQKVILQRIEArwiheasgrvynldynppkvp 153 RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxx ...............DneEtvkkRLetYhkqTePvIdyYkkkgk<-* +++ +++ +++++D++ + kRL++Y++++eP+ +Yk++g Candida_al 154 fkddvtgealtkrqdDTAQVFQKRLDQYNEEIEPLKVFYKQQGL 197 //