Query: Candida_albicans_chr7-r3-188814-188026-9 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SRF-TF SRF-type transcription factor (DNA-binding a 96.7 4.7e-25 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SRF-TF 1/1 66 116 .. 1 51 [] 96.7 4.7e-25 Alignments of top-scoring domains: SRF-TF: domain 1 of 1, from 66 to 116: score 96.7, E = 4.7e-25 *->krIenksnrqVTfsKRrnGllKKAhELSVLCdaeVaviifsstGkly k+I ks+r++TfsKR++G++KKA+ELSVL++++V+++++s+tG +y Candida_al 66 KFIQEKSRRHITFSKRKAGIMKKAYELSVLTGTQVLLLVVSETGLVY 112 eyss<-* ++ + Candida_al 113 TFTT 116 //