Query: Candida_albicans_chr7-r3-206043-205036-8 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- homeobox Homeobox domain 68.0 2.1e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- homeobox 1/1 174 230 .. 1 57 [] 68.0 2.1e-16 Alignments of top-scoring domains: homeobox: domain 1 of 1, from 174 to 230: score 68.0, E = 2.1e-16 *->RrkRTtFtpeQleeLEkeFqknpYPsreeReeLAkkLgLterqVkvW RrkR + +p+ l+ L +eF+ P++++R+++Akk +te V++W Candida_al 174 RRKRRRTSPHELNILNQEFALGTTPNKSRRIQIAKKVSMTEKAVQIW 220 FQNRRaKwKk<-* FQN+R+ +k Candida_al 221 FQNKRQSIRK 230 //